PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g085630.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 213aa    MW: 24875 Da    PI: 5.2552
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g085630.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.6e-2057109456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++++++eq++ Le+ F  ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Sopim02g085630.0.1  57 KRKLSEEQVNLLEQSFGDEHKLESERKDKLAAELGLDPRQVAVWFQNRRARWK 109
                         45899***********************************************9 PP

2HD-ZIP_I/II120.21.1e-3856147293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +kr+ls+eqv+lLE+sF  e+kLe+erK +la eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++d+ + e++rLe+ev +L+e+l+
  Sopim02g085630.0.1  56 RKRKLSEEQVNLLEQSFGDEHKLESERKDKLAAELGLDPRQVAVWFQNRRARWKSKKLEEEYSKLKSEHDNNVVEKCRLETEVLKLKEQLN 146
                         8****************************************************************************************98 PP

         HD-ZIP_I/II  93 e 93 
                         e
  Sopim02g085630.0.1 147 E 147
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.92551111IPR001356Homeobox domain
SMARTSM003896.9E-2054115IPR001356Homeobox domain
CDDcd000869.72E-1756112No hitNo description
PfamPF000465.0E-1757109IPR001356Homeobox domain
SuperFamilySSF466896.84E-1857120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-2058118IPR009057Homeodomain-like
PRINTSPR000315.8E-68291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000315.8E-691107IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MNHQVIEDDN MVLISQYYPD IYTQLVPQQG ESKPRRRRKK NKLGEGSGND QMMMMRKRKL  60
SEEQVNLLEQ SFGDEHKLES ERKDKLAAEL GLDPRQVAVW FQNRRARWKS KKLEEEYSKL  120
KSEHDNNVVE KCRLETEVLK LKEQLNESEK EIQRLLLERC DGVSSNYTSP SASSFSMEAP  180
FLGEFGMDGL DNVFYAQENN YVQGLDWVNL YI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13758RKKNKLGEGSGNDQMMMMRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2260010.0AC226001.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0116F10, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232382.11e-156PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotO232082e-78ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLK4BB741e-156K4BB74_SOLLC; Uncharacterized protein
STRINGSolyc02g085630.2.11e-156(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.16e-70homeobox protein 40